PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12271.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 259aa    MW: 28684.2 Da    PI: 8.8617
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12271.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.59.2e-33101157158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 d p+YVNaKQy++Il+RRq+Rakle+++kl +k+rkpylheSRh+hAl+R RgsgGrF
  KHN12271.1 101 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-IKNRKPYLHESRHRHALNRVRGSGGRF 157
                 57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.7E-3799160IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.224100160IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.2E-28103157IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-24103125IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860105125IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.1E-24134157IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MLAEPAMATF LLNTRLDLIL SDSSDDYIEG YMKPFLFLNL PNTEFNSSQV DCNHSMAHSS  60
YPYGDPIFAY GPQAISHPQM IPPMLGLAST RVALPLDLAE DGPIYVNAKQ YHGILRRRQS  120
RAKLEAQNKL IKNRKPYLHE SRHRHALNRV RGSGGRFLST KQLAQSNAEF VTGAHSGSDP  180
TNRYQKEHLS EVESHSSKDG DNSSFITTCS DRPCLSGNNV NFRQQECMFL GNSANMGGSP  240
QFSGGLTFGG AKQRTSVVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-23101162263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0993700.0BT099370.1 Soybean clone JCVI-FLGm-13B20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533780.11e-171PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0B2PSG70.0A0A0B2PSG7_GLYSO; Nuclear transcription factor Y subunit A-3
STRINGGLYMA09G07960.21e-171(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69493149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.15e-40nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]